Lineage for d4fxca_ (4fxc A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854217Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 854218Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 854219Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 854293Species Spirulina platensis [TaxId:118562] [54296] (1 PDB entry)
  8. 854294Domain d4fxca_: 4fxc A: [37663]
    complexed with fes

Details for d4fxca_

PDB Entry: 4fxc (more details), 2.5 Å

PDB Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d4fxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fxca_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spirulina platensis [TaxId: 118562]}
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly

SCOP Domain Coordinates for d4fxca_:

Click to download the PDB-style file with coordinates for d4fxca_.
(The format of our PDB-style files is described here.)

Timeline for d4fxca_: