SCOP 1.73: Domain d4fxca_: 4fxc A:

Lineage for d4fxca_ (4fxc A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Spirulina platensis [TaxId:118562] [54296] (1 PDB entry)

8. Domain d4fxca_: 4fxc A: [37663]
   complexed with fes

Details for d4fxca_

PDB Entry: 4fxc, 2.5 Å

PDB Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis

PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d4fxca_:

Sequence; same for both SEQRES and ATOM records:

>d4fxca_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spirulina platensis [TaxId: 118562]}
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly

Timeline for d4fxca_:

• d4fxca_ first appeared (with stable ids) in SCOP 1.55, called d4fxc__
  
• d4fxca_ was called d4fxc__ in SCOP 1.71
  
• d4fxca_ appears in SCOP 1.75
  
• d4fxca_ appears in the current release, SCOPe 2.08