Lineage for d4fxc__ (4fxc -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325573Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 325574Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 325575Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 325624Species Spirulina platensis [TaxId:118562] [54296] (1 PDB entry)
  8. 325625Domain d4fxc__: 4fxc - [37663]
    complexed with fes

Details for d4fxc__

PDB Entry: 4fxc (more details), 2.5 Å

PDB Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis

SCOP Domain Sequences for d4fxc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fxc__ d.15.4.1 (-) 2Fe-2S ferredoxin {Spirulina platensis}
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly

SCOP Domain Coordinates for d4fxc__:

Click to download the PDB-style file with coordinates for d4fxc__.
(The format of our PDB-style files is described here.)

Timeline for d4fxc__: