SCOP 1.63: Domain d4fxc__: 4fxc -

Lineage for d4fxc__ (4fxc -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (16 species)

7. Species Spirulina platensis [TaxId:118562] [54296] (1 PDB entry)

8. Domain d4fxc__: 4fxc - [37663]
   complexed with fes

Details for d4fxc__

PDB Entry: 4fxc, 2.5 Å

PDB Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis

SCOP Domain Sequences for d4fxc__:

Sequence; same for both SEQRES and ATOM records:

>d4fxc__ d.15.4.1 (-) 2Fe-2S ferredoxin {Spirulina platensis}
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly

Timeline for d4fxc__:

• d4fxc__ first appeared (with stable ids) in SCOP 1.55
  
• d4fxc__ appears in SCOP 1.61
  
• d4fxc__ appears in SCOP 1.65
  
• d4fxc__ appears in the current release, SCOPe 2.08, called d4fxca_