Lineage for d4fxc__ (4fxc -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) Protein 2Fe-2S ferredoxin [54294] (11 species) 
Species Spirulina platensis [TaxId:118562] [54296] (1 PDB entry) 
Domain d4fxc__: 4fxc - [37663]
Details for d4fxc__
PDB Entry: 4fxc (more details), 2.5 Å
PDB Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
SCOP Domain Sequences for d4fxc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fxc__ d.15.4.1 (-) 2Fe-2S ferredoxin {Spirulina platensis}
atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
sdqsfldddqieagyvltcvayptsdctikthqeegly
SCOP Domain Coordinates for d4fxc__:
Click to download the PDB-style file with coordinates for d4fxc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fxc__:
- d4fxc__ appears in SCOP 1.57
- d4fxc__ appears in the current release, SCOPe 2.08, called d4fxca_
View in 3D