Lineage for d6su8b_ (6su8 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390998Species Talaromyces emersonii [TaxId:68825] [376621] (1 PDB entry)
  8. 2391000Domain d6su8b_: 6su8 B: [376624]
    automated match to d1a39a_
    complexed with bma, mli, na, nag, pca

Details for d6su8b_

PDB Entry: 6su8 (more details), 2.48 Å

PDB Description: highly thermostable endoglucanase cel7b
PDB Compounds: (B:) glucanase

SCOPe Domain Sequences for d6su8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6su8b_ b.29.1.0 (B:) automated matches {Talaromyces emersonii [TaxId: 68825]}
eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
pcnstegnpatieaqhpdtavtfsnirwgdigstfq

SCOPe Domain Coordinates for d6su8b_:

Click to download the PDB-style file with coordinates for d6su8b_.
(The format of our PDB-style files is described here.)

Timeline for d6su8b_: