Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Talaromyces emersonii [TaxId:68825] [376621] (1 PDB entry) |
Domain d6su8b_: 6su8 B: [376624] automated match to d1a39a_ complexed with bma, mli, na, nag, pca |
PDB Entry: 6su8 (more details), 2.48 Å
SCOPe Domain Sequences for d6su8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6su8b_ b.29.1.0 (B:) automated matches {Talaromyces emersonii [TaxId: 68825]} eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag pcnstegnpatieaqhpdtavtfsnirwgdigstfq
Timeline for d6su8b_: