Lineage for d6poha_ (6poh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486299Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2486300Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2486310Species Escherichia coli [TaxId:562] [100955] (185 PDB entries)
  8. 2486332Domain d6poha_: 6poh A: [376614]
    automated match to d1fvka_
    complexed with cu, ovg

Details for d6poha_

PDB Entry: 6poh (more details), 1.67 Å

PDB Description: crystal structure of ecdsba in complex alkyl ether 21
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d6poha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6poha_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d6poha_:

Click to download the PDB-style file with coordinates for d6poha_.
(The format of our PDB-style files is described here.)

Timeline for d6poha_: