SCOPe 2.07: Domain d6qpue1: 6qpu E:5-163

Lineage for d6qpue1 (6qpu E:5-163)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Ralstonia sp. [TaxId:658080] [376582] (1 PDB entry)

8. Domain d6qpue1: 6qpu E:5-163 [376602]
   automated match to d5tb7a1
   complexed with cl, cu, pg4

Details for d6qpue1

PDB Entry: 6qpu, 2.25 Å

PDB Description: crystal structure of as isolated synthetic core domain of nitrite reductase from ralstonia pickettii (residues 1-331)

PDB Compounds: (E:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6qpue1:

Sequence; same for both SEQRES and ATOM records:

>d6qpue1 b.6.1.0 (E:5-163) automated matches {Ralstonia sp. [TaxId: 658080]}
lpgdfgpprgepihavltspplvpppvnrtypakvivelevvekemqisegvsytfwtfg
gtvpgsfirvrqgdtvefhlknhpsskmphnidlhgvtgpgggaassftapghesqftfk
alnegiyvyhcatapvgmhiangmyglilveppeglpkv

Timeline for d6qpue1:

• d6qpue1 is new in SCOPe 2.07-stable
  
• d6qpue1 appears in the current release, SCOPe 2.08