Lineage for d1fxaa_ (1fxa A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189382Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 189383Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 189384Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 189392Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 189408Domain d1fxaa_: 1fxa A: [37660]

Details for d1fxaa_

PDB Entry: 1fxa (more details), 2.5 Å

PDB Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120

SCOP Domain Sequences for d1fxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxaa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1fxaa_:

Click to download the PDB-style file with coordinates for d1fxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fxaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fxab_