| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
| Protein 2Fe-2S ferredoxin [54294] (16 species) |
| Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries) |
| Domain d1qobb_: 1qob B: [37656] complexed with fes, so4; mutant |
PDB Entry: 1qob (more details), 1.8 Å
SCOP Domain Sequences for d1qobb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qobb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
skqsfldddqieagyvltcvayptsdvviqthkeedly
Timeline for d1qobb_: