SCOPe 2.08: Domain d6ottb2: 6ott B:250-496

Lineage for d6ottb2 (6ott B:250-496)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species)

7. Species Escherichia coli [TaxId:83333] [376542] (2 PDB entries)

8. Domain d6ottb2: 6ott B:250-496 [376543]
   Other proteins in same PDB: d6otta1, d6ottb1
   automated match to d1ecfb1
   complexed with mg, n7y

Details for d6ottb2

PDB Entry: 6ott, 2.55 Å

PDB Description: structure of purf in complex with ppapp

PDB Compounds: (B:) Amidophosphoribosyltransferase, PurF

SCOPe Domain Sequences for d6ottb2:

Sequence; same for both SEQRES and ATOM records:

>d6ottb2 c.61.1.1 (B:250-496) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 83333]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrqneve

Timeline for d6ottb2:

• d6ottb2 first appeared in SCOPe 2.07