Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [376530] (1 PDB entry) |
Domain d6pcoc_: 6pco C: [376531] automated match to d1jgsa_ complexed with bu1 |
PDB Entry: 6pco (more details), 2.75 Å
SCOPe Domain Sequences for d6pcoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pcoc_ a.4.5.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]} eqvghllrrayqrhvaifqqtipdskltaaqfvvlcalrdqgacslvdvvkataidqatv rgvierlkarkllavshdpadrrkvlvtltpdgralveemvpfaeqitqstfgglnpaer vaivyllrkmsd
Timeline for d6pcoc_: