Lineage for d6pcoc_ (6pco C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308030Species Bordetella bronchiseptica [TaxId:518] [376530] (1 PDB entry)
  8. 2308033Domain d6pcoc_: 6pco C: [376531]
    automated match to d1jgsa_
    complexed with bu1

Details for d6pcoc_

PDB Entry: 6pco (more details), 2.75 Å

PDB Description: mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid
PDB Compounds: (C:) MarR-family transcriptional regulator

SCOPe Domain Sequences for d6pcoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pcoc_ a.4.5.0 (C:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
eqvghllrrayqrhvaifqqtipdskltaaqfvvlcalrdqgacslvdvvkataidqatv
rgvierlkarkllavshdpadrrkvlvtltpdgralveemvpfaeqitqstfgglnpaer
vaivyllrkmsd

SCOPe Domain Coordinates for d6pcoc_:

Click to download the PDB-style file with coordinates for d6pcoc_.
(The format of our PDB-style files is described here.)

Timeline for d6pcoc_: