SCOP 1.73: Domain d1qofa_: 1qof A:

Lineage for d1qofa_ (1qof A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1qofa_: 1qof A: [37653]

Details for d1qofa_

PDB Entry: 1qof, 1.8 Å

PDB Description: ferredoxin mutation q70k

PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d1qofa_:

Sequence; same for both SEQRES and ATOM records:

>d1qofa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddkieagyvltcvayptsdvviqthkeedly

Timeline for d1qofa_:

• d1qofa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qofa_ appears in SCOP 1.71
  
• d1qofa_ appears in SCOP 1.75
  
• d1qofa_ appears in the current release, SCOPe 2.08