Lineage for d1qofa_ (1qof A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30501Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 30502Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 30503Protein 2Fe-2S ferredoxin [54294] (11 species)
  7. 30506Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 30517Domain d1qofa_: 1qof A: [37653]

Details for d1qofa_

PDB Entry: 1qof (more details), 1.8 Å

PDB Description: ferredoxin mutation q70k

SCOP Domain Sequences for d1qofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qofa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddkieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1qofa_:

Click to download the PDB-style file with coordinates for d1qofa_.
(The format of our PDB-style files is described here.)

Timeline for d1qofa_: