SCOPe 2.07: Domain d6mytd_: 6myt D:

Lineage for d6mytd_ (6myt D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein automated matches [254461] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries)

8. Domain d6mytd_: 6myt D: [376522]
   Other proteins in same PDB: d6mytb1, d6mytb2
   automated match to d1yq3d_
   complexed with 3pe, at5, f3s, fad, fes, hem, k, oaa, peg, sf4, umq, unl

Details for d6mytd_

PDB Entry: 6myt, 2.27 Å

PDB Description: avian mitochondrial complex ii with atpenin a5 bound, sidechain in pocket

PDB Compounds: (D:) Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

SCOPe Domain Sequences for d6mytd_:

Sequence; same for both SEQRES and ATOM records:

>d6mytd_ f.21.2.2 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhg
dtpikvantglyvlsaitftglcyfnyydvgickavamlwsi

Timeline for d6mytd_:

• d6mytd_ is new in SCOPe 2.07-stable
  
• d6mytd_ appears in the current release, SCOPe 2.08