SCOP 1.63: Domain d1qoab_: 1qoa B:

Lineage for d1qoab_ (1qoa B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (16 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)

8. Domain d1qoab_: 1qoa B: [37650]
   complexed with fes; mutant

Details for d1qoab_

PDB Entry: 1qoa, 1.7 Å

PDB Description: ferredoxin mutation c49s

SCOP Domain Sequences for d1qoab_:

Sequence; same for both SEQRES and ATOM records:

>d1qoab_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstsagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

Timeline for d1qoab_:

• d1qoab_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoab_ appears in SCOP 1.61
  
• d1qoab_ appears in SCOP 1.65
  
• d1qoab_ appears in the current release, SCOPe 2.08