Lineage for d1qoaa_ (1qoa A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325573Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 325574Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)
  6. 325575Protein 2Fe-2S ferredoxin [54294] (16 species)
  7. 325583Species Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 325588Domain d1qoaa_: 1qoa A: [37649]

Details for d1qoaa_

PDB Entry: 1qoa (more details), 1.7 Å

PDB Description: ferredoxin mutation c49s

SCOP Domain Sequences for d1qoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoaa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstsagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

SCOP Domain Coordinates for d1qoaa_:

Click to download the PDB-style file with coordinates for d1qoaa_.
(The format of our PDB-style files is described here.)

Timeline for d1qoaa_: