Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [375655] (7 PDB entries) |
Domain d6mypb1: 6myp B:8-114 [376480] Other proteins in same PDB: d6mypb2, d6mypd_ automated match to d2h89b1 complexed with 3pe, bct, f3s, fad, fes, hem, k, mg, oaa, peg, sf4, ttf, umq, unl |
PDB Entry: 6myp (more details), 2.1 Å
SCOPe Domain Sequences for d6mypb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mypb1 d.15.4.2 (B:8-114) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
Timeline for d6mypb1: