SCOPe 2.07: Domain d6mysb2: 6mys B:115-247

Lineage for d6mysb2 (6mys B:115-247)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein automated matches [231469] (5 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [375657] (7 PDB entries)

8. Domain d6mysb2: 6mys B:115-247 [376436]
   Other proteins in same PDB: d6mysb1, d6mysd_
   automated match to d1yq3b2
   complexed with 3pe, at5, f3s, fad, fes, hem, k, oaa, sf4, umq, unl

Details for d6mysb2

PDB Entry: 6mys, 2.37 Å

PDB Description: avian mitochondrial complex ii with atpenin a5 bound, sidechain outside

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d6mysb2:

Sequence; same for both SEQRES and ATOM records:

>d6mysb2 a.1.2.1 (B:115-247) automated matches {Gallus gallus [TaxId: 9031]}
lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka
iaeikkmmatyke

Timeline for d6mysb2:

• d6mysb2 is new in SCOPe 2.07-stable
  
• d6mysb2 appears in the current release, SCOPe 2.08