![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [375655] (7 PDB entries) |
![]() | Domain d6mysb1: 6mys B:8-114 [376435] Other proteins in same PDB: d6mysb2, d6mysd_ automated match to d2h89b1 complexed with 3pe, at5, f3s, fad, fes, hem, k, oaa, sf4, umq, unl |
PDB Entry: 6mys (more details), 2.37 Å
SCOPe Domain Sequences for d6mysb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mysb1 d.15.4.2 (B:8-114) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd
Timeline for d6mysb1: