SCOP 1.57: Domain d1fm0d_: 1fm0 D:

Lineage for d1fm0d_ (1fm0 D:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.3: MoaD/ThiS [54285] (2 families)

5. Family d.15.3.1: Molybdopterin synthase subunit MoaD [54286] (1 protein)

6. Protein Molybdopterin synthase subunit MoaD [54287] (1 species)

7. Species Escherichia coli [TaxId:562] [54288] (2 PDB entries)

8. Domain d1fm0d_: 1fm0 D: [37642]
   Other proteins in same PDB: d1fm0e_

Details for d1fm0d_

PDB Entry: 1fm0, 1.45 Å

PDB Description: molybdopterin synthase (moad/moae)

SCOP Domain Sequences for d1fm0d_:

Sequence; same for both SEQRES and ATOM records:

>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

Timeline for d1fm0d_:

• d1fm0d_ first appeared (with stable ids) in SCOP 1.55
  
• d1fm0d_ appears in SCOP 1.59
  
• d1fm0d_ appears in the current release, SCOPe 2.08