![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein automated matches [254461] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [254987] (13 PDB entries) |
![]() | Domain d6myqd_: 6myq D: [376417] Other proteins in same PDB: d6myqb1, d6myqb2 automated match to d1yq3d_ complexed with 3pe, 9au, f3s, fad, fes, hem, k, moh, peg, sf4, umq, unl, y3p |
PDB Entry: 6myq (more details), 1.97 Å
SCOPe Domain Sequences for d6myqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6myqd_ f.21.2.2 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} sskaaslhwtseravsalllgllpaaylypgpavdyslaaaltlhghwglgqvitdyvhg dtpikvantglyvlsaitftglcyfnyydvgickavamlwsi
Timeline for d6myqd_: