SCOP 1.57: Domain d1f2rc_: 1f2r C:

Lineage for d1f2rc_ (1f2r C:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)

5. Family d.15.2.1: CAD domain [54278] (3 proteins)

6. Protein Caspase-activated DNase (CAD), DFF40, N-terminal domain [54281] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [54282] (2 PDB entries)

8. Domain d1f2rc_: 1f2r C: [37640]
   Other proteins in same PDB: d1f2ri_

Details for d1f2rc_

PDB Entry: 1f2r

PDB Description: nmr structure of the heterodimeric complex between cad domains of cad and icad

SCOP Domain Sequences for d1f2rc_:

Sequence; same for both SEQRES and ATOM records:

>d1f2rc_ d.15.2.1 (C:) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Mouse (Mus musculus)}
mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
dcfpglpndaelllltagetwhgyvsd

Timeline for d1f2rc_:

• d1f2rc_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2rc_ appears in SCOP 1.59
  
• d1f2rc_ appears in the current release, SCOPe 2.08