Lineage for d1c9fa_ (1c9f A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.2: CAD domain [54277] (1 family) 
Family d.15.2.1: CAD domain [54278] (3 proteins) 
Protein Caspase-activated DNase (CAD), N-terminal domain [54281] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54282] (2 PDB entries) 
Domain d1c9fa_: 1c9f A: [37639]
Details for d1c9fa_
PDB Entry: 1c9f (more details)
PDB Description: nmr structure of the cad domain of caspase-activated dnase
SCOP Domain Sequences for d1c9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9fa_ d.15.2.1 (A:) Caspase-activated DNase (CAD), N-terminal domain {Mouse (Mus musculus)}
mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
dcfpglpndaelllltagetwhgyvsd
SCOP Domain Coordinates for d1c9fa_:
Click to download the PDB-style file with coordinates for d1c9fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c9fa_:
- d1c9fa_ appears in SCOP 1.57
- d1c9fa_ appears in the current release, SCOPe 2.08
View in 3D