Lineage for d1d4ba_ (1d4b A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) 
Family d.15.2.1: CAD domain [54278] (3 proteins) Protein Cell death-inducing effector B (CIDE-B), N-terminal domain [54279] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54280] (1 PDB entry) 
Domain d1d4ba_: 1d4b A: [37638]
Details for d1d4ba_
PDB Entry: 1d4b (more details)
PDB Description: cide-n domain of human cide-b
SCOP Domain Sequences for d1d4ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4ba_ d.15.2.1 (A:) Cell death-inducing effector B (CIDE-B), N-terminal domain {Human (Homo sapiens)}
meylsalnpsdllrsvsnissefgrrvwtsapppqrpfrvcdhkrtirkgltaatrqell
akaletlllngvltlvleedgtavdsedffqlleddtclmvlqsgqswsptrsgvlhhhh
hh
SCOP Domain Coordinates for d1d4ba_:
Click to download the PDB-style file with coordinates for d1d4ba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d4ba_:
- d1d4ba_ first appeared (with stable ids) in SCOP 1.55
- d1d4ba_ appears in SCOP 1.59
- d1d4ba_ appears in the current release, SCOPe 2.08, called d1d4ba1
View in 3D