Lineage for d1e8ya3 (1e8y A:143-322)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 130888Superfamily d.15.1: Ubiquitin-like [54236] (5 families) (S)
  5. 130966Family d.15.1.5: Ras-binding domain, RBD [54263] (6 proteins)
  6. 130974Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
  7. 130975Species Human (Homo sapiens) [TaxId:9606] [54276] (3 PDB entries)
  8. 130976Domain d1e8ya3: 1e8y A:143-322 [37635]
    Other proteins in same PDB: d1e8ya1, d1e8ya2, d1e8ya4

Details for d1e8ya3

PDB Entry: 1e8y (more details), 2 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine

SCOP Domain Sequences for d1e8ya3:

Sequence, based on SEQRES records: (download)

>d1e8ya3 d.15.1.5 (A:143-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

Sequence, based on observed residues (ATOM records): (download)

>d1e8ya3 d.15.1.5 (A:143-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

SCOP Domain Coordinates for d1e8ya3:

Click to download the PDB-style file with coordinates for d1e8ya3.
(The format of our PDB-style files is described here.)

Timeline for d1e8ya3: