SCOPe 2.07: Domain d6u62e_: 6u62 E:

Lineage for d6u62e_ (6u62 E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)

8. Domain d6u62e_: 6u62 E: [376336]
   automated match to d1szva_
   complexed with gdp, gtp, mg

Details for d6u62e_

PDB Entry: 6u62, 3.18 Å

PDB Description: raptor-rag-ragulator complex

PDB Compounds: (E:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d6u62e_:

Sequence; same for both SEQRES and ATOM records:

>d6u62e_ d.110.7.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrpkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrng
nqafnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleeplt
qvaa

Timeline for d6u62e_:

• d6u62e_ is new in SCOPe 2.07-stable
  
• d6u62e_ appears in the current release, SCOPe 2.08