Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Faecalibacterium prausnitzii [TaxId:853] [376256] (1 PDB entry) |
Domain d6u7ib1: 6u7i B:2-198 [376320] Other proteins in same PDB: d6u7ia2, d6u7ia3, d6u7ib2, d6u7ib3, d6u7ic2, d6u7ic3, d6u7id2, d6u7id3 automated match to d3hn3a1 |
PDB Entry: 6u7i (more details), 2.7 Å
SCOPe Domain Sequences for d6u7ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7ib1 b.18.1.0 (B:2-198) automated matches {Faecalibacterium prausnitzii [TaxId: 853]} lypeqnearlklsldgtwafalgscaetqfdpakplpdaqpiavpasyndqndqttalrr hygwvwyqrkvtlpafcagqrvvlrfgsvthtakvwlngqliaqhkggftpfeadvtall qpgetalltvacdnrvnhstlpvgnedgqlaffgsdnagipsveaakraaapqnrpnfdf fnyagihrpvvlyttpk
Timeline for d6u7ib1: