Lineage for d1e8xa3 (1e8x A:142-321)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717441Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
    contains Pfam PF00788 and Pfam 02196
  6. 717458Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 717463Species Pig (Sus scrofa) [TaxId:9823] [54275] (5 PDB entries)
  8. 717468Domain d1e8xa3: 1e8x A:142-321 [37631]
    Other proteins in same PDB: d1e8xa1, d1e8xa2, d1e8xa4
    complexed with atp, lu; mutant

Details for d1e8xa3

PDB Entry: 1e8x (more details), 2.2 Å

PDB Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOP Domain Sequences for d1e8xa3:

Sequence, based on SEQRES records: (download)

>d1e8xa3 d.15.1.5 (A:142-321) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) [TaxId: 9823]}
aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdi
pesqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d1e8xa3 d.15.1.5 (A:142-321) Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) [TaxId: 9823]}
aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmanerdfvlr
vcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke

SCOP Domain Coordinates for d1e8xa3:

Click to download the PDB-style file with coordinates for d1e8xa3.
(The format of our PDB-style files is described here.)

Timeline for d1e8xa3: