Lineage for d6u7ic2 (6u7i C:199-285)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373231Species Faecalibacterium prausnitzii [TaxId:853] [376258] (1 PDB entry)
  8. 2373234Domain d6u7ic2: 6u7i C:199-285 [376309]
    Other proteins in same PDB: d6u7ia1, d6u7ia3, d6u7ib1, d6u7ib3, d6u7ic1, d6u7ic3, d6u7id1, d6u7id3
    automated match to d3hn3a2

Details for d6u7ic2

PDB Entry: 6u7i (more details), 2.7 Å

PDB Description: faecalibacterium prausnitzii beta-glucuronidase
PDB Compounds: (C:) beta-glucuronidase

SCOPe Domain Sequences for d6u7ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7ic2 b.1.4.0 (C:199-285) automated matches {Faecalibacterium prausnitzii [TaxId: 853]}
eyiedvtivpavdgtvqyavkttgsapvrvtvldadgnavasaesaegtitipevhlwep
rpgtpylytlhatcgadvydqtfgvrs

SCOPe Domain Coordinates for d6u7ic2:

Click to download the PDB-style file with coordinates for d6u7ic2.
(The format of our PDB-style files is described here.)

Timeline for d6u7ic2: