Lineage for d6u7ic1 (6u7i C:1-198)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775215Species Faecalibacterium prausnitzii [TaxId:853] [376256] (1 PDB entry)
  8. 2775218Domain d6u7ic1: 6u7i C:1-198 [376308]
    Other proteins in same PDB: d6u7ia2, d6u7ia3, d6u7ib2, d6u7ib3, d6u7ic2, d6u7ic3, d6u7id2, d6u7id3
    automated match to d3hn3a1

Details for d6u7ic1

PDB Entry: 6u7i (more details), 2.7 Å

PDB Description: faecalibacterium prausnitzii beta-glucuronidase
PDB Compounds: (C:) beta-glucuronidase

SCOPe Domain Sequences for d6u7ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7ic1 b.18.1.0 (C:1-198) automated matches {Faecalibacterium prausnitzii [TaxId: 853]}
mlypeqnearlklsldgtwafalgscaetqfdpakplpdaqpiavpasyndqndqttalr
rhygwvwyqrkvtlpafcagqrvvlrfgsvthtakvwlngqliaqhkggftpfeadvtal
lqpgetalltvacdnrvnhstlpvgnedgqlaffgsdnagipsveaakraaapqnrpnfd
ffnyagihrpvvlyttpk

SCOPe Domain Coordinates for d6u7ic1:

Click to download the PDB-style file with coordinates for d6u7ic1.
(The format of our PDB-style files is described here.)

Timeline for d6u7ic1: