Lineage for d1ef5a_ (1ef5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893599Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1893716Protein Rgl [54272] (1 species)
  7. 1893717Species Mouse (Mus musculus) [TaxId:10090] [54273] (1 PDB entry)
  8. 1893718Domain d1ef5a_: 1ef5 A: [37629]

Details for d1ef5a_

PDB Entry: 1ef5 (more details)

PDB Description: solution structure of the ras-binding domain of rgl
PDB Compounds: (A:) rgl

SCOPe Domain Sequences for d1ef5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef5a_ d.15.1.5 (A:) Rgl {Mouse (Mus musculus) [TaxId: 10090]}
edtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvqvisedk
elvipdsanvfyamnsqvnfdfilrkkn

SCOPe Domain Coordinates for d1ef5a_:

Click to download the PDB-style file with coordinates for d1ef5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef5a_: