Lineage for d1ef5a_ (1ef5 A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) 
Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
contains Pfam PF00788 and Pfam 02196
Protein Rgl [54272] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [54273] (1 PDB entry) 
Domain d1ef5a_: 1ef5 A: [37629]
Details for d1ef5a_
PDB Entry: 1ef5 (more details)
PDB Description: solution structure of the ras-binding domain of rgl
PDB Compounds: (A:) rglSCOP Domain Sequences for d1ef5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef5a_ d.15.1.5 (A:) Rgl {Mouse (Mus musculus) [TaxId: 10090]}
edtciirisvednngnmyksimltsqdktpaviqramskhnlesdpaeeyelvqvisedk
elvipdsanvfyamnsqvnfdfilrkkn
SCOP Domain Coordinates for d1ef5a_:
Click to download the PDB-style file with coordinates for d1ef5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ef5a_:
- d1ef5a_ first appeared (with stable ids) in SCOP 1.55
- d1ef5a_ appears in SCOP 1.71
- d1ef5a_ appears in SCOP 1.75
- d1ef5a_ appears in the current release, SCOPe 2.08
View in 3D