Lineage for d1raxa_ (1rax A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178530Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2178633Protein Ral guanosine-nucleotide exchange factor, RalGDS [54267] (2 species)
  7. 2178634Species Human (Homo sapiens) [TaxId:9606] [54269] (3 PDB entries)
  8. 2178636Domain d1raxa_: 1rax A: [37626]

Details for d1raxa_

PDB Entry: 1rax (more details)

PDB Description: ra-domain of ral guanosine-nucleotide dissociation stimulator
PDB Compounds: (A:) protein (ra-domain of ral guanosine dissociation stimulator)

SCOPe Domain Sequences for d1raxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1raxa_ d.15.1.5 (A:) Ral guanosine-nucleotide exchange factor, RalGDS {Human (Homo sapiens) [TaxId: 9606]}
qqvgdcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqils
ddrklkipenanvfyamnstanydfvlkkrtft

SCOPe Domain Coordinates for d1raxa_:

Click to download the PDB-style file with coordinates for d1raxa_.
(The format of our PDB-style files is described here.)

Timeline for d1raxa_: