Lineage for d1raxa_ (1rax A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.1: Ubiquitin-like [54236] (5 families) 
Family d.15.1.5: Ras-binding domain, RBD [54263] (5 proteins) 
Protein Ral guanosine-nucleotide exchange factor, RalGDS [54267] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [54269] (2 PDB entries) 
Domain d1raxa_: 1rax A: [37626]
Details for d1raxa_
PDB Entry: 1rax (more details)
PDB Description: ra-domain of ral guanosine-nucleotide dissociation stimulator
SCOP Domain Sequences for d1raxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1raxa_ d.15.1.5 (A:) Ral guanosine-nucleotide exchange factor, RalGDS {Human (Homo sapiens)}
qqvgdcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqils
ddrklkipenanvfyamnstanydfvlkkrtft
SCOP Domain Coordinates for d1raxa_:
Click to download the PDB-style file with coordinates for d1raxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1raxa_:
- d1raxa_ appears in SCOP 1.57
- d1raxa_ appears in the current release, SCOPe 2.08
View in 3D