Lineage for d6kcja2 (6kcj A:333-503)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 3058991Species Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId:1490024] [359053] (4 PDB entries)
  8. 3076173Domain d6kcja2: 6kcj A:333-503 [376235]
    Other proteins in same PDB: d6kcja1, d6kcja3
    automated match to d1ha0a2
    complexed with nag; mutant

Details for d6kcja2

PDB Entry: 6kcj (more details), 2.46 Å

PDB Description: crystal structure of h5n2 hemagglutinin apo-q226l mutant from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6kcja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kcja2 h.3.1.0 (A:333-503) automated matches {Influenza a virus (a/chicken/taiwan/0502/2012(h5n2)) [TaxId: 1490024]}
gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqf
eavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvr
rqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid

SCOPe Domain Coordinates for d6kcja2:

Click to download the PDB-style file with coordinates for d6kcja2.
(The format of our PDB-style files is described here.)

Timeline for d6kcja2: