Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [195692] (5 PDB entries) |
Domain d6l33d_: 6l33 D: [376218] Other proteins in same PDB: d6l33b2 automated match to d2y7ka_ complexed with so4 |
PDB Entry: 6l33 (more details), 2 Å
SCOPe Domain Sequences for d6l33d_:
Sequence, based on SEQRES records: (download)
>d6l33d_ c.94.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} avfriglsddvefgllppllrrlraeapgivlvvrranyllmpnllasgeisvgvsytde lpanakrktvrrskpkilradsapgqltlddycarphalvsfagdlsgfvdeelekfgrk rkvvlavpqfnglgtllagtdiiatvpdyaaqaliaagglraedppfetrafelsmawrg aqdndpaerwlrsrismfig
>d6l33d_ c.94.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} avfriglsddvefgllppllrrlraeapgivlvvrranyllmpnllasgeisvgvsytde lpanakrktvrrskpkilradsapgqltlddycarphalvsfagrkrkvvlavpqfnglg tllagtdiiatvpdyaaqalialraedppfetrafelsmawrgaqdndpaerwlrsrism fig
Timeline for d6l33d_:
View in 3D Domains from other chains: (mouse over for more information) d6l33a_, d6l33b1, d6l33b2, d6l33c_ |