Lineage for d6l33d_ (6l33 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915990Species Pseudomonas aeruginosa [TaxId:287] [195692] (5 PDB entries)
  8. 2916001Domain d6l33d_: 6l33 D: [376218]
    Other proteins in same PDB: d6l33b2
    automated match to d2y7ka_
    complexed with so4

Details for d6l33d_

PDB Entry: 6l33 (more details), 2 Å

PDB Description: crystal structure of the regulatory domain of mext, a transcriptional activator in pseudomonas aeruginosa
PDB Compounds: (D:) MexT protein

SCOPe Domain Sequences for d6l33d_:

Sequence, based on SEQRES records: (download)

>d6l33d_ c.94.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
avfriglsddvefgllppllrrlraeapgivlvvrranyllmpnllasgeisvgvsytde
lpanakrktvrrskpkilradsapgqltlddycarphalvsfagdlsgfvdeelekfgrk
rkvvlavpqfnglgtllagtdiiatvpdyaaqaliaagglraedppfetrafelsmawrg
aqdndpaerwlrsrismfig

Sequence, based on observed residues (ATOM records): (download)

>d6l33d_ c.94.1.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
avfriglsddvefgllppllrrlraeapgivlvvrranyllmpnllasgeisvgvsytde
lpanakrktvrrskpkilradsapgqltlddycarphalvsfagrkrkvvlavpqfnglg
tllagtdiiatvpdyaaqalialraedppfetrafelsmawrgaqdndpaerwlrsrism
fig

SCOPe Domain Coordinates for d6l33d_:

Click to download the PDB-style file with coordinates for d6l33d_.
(The format of our PDB-style files is described here.)

Timeline for d6l33d_: