Lineage for d1rrba_ (1rrb A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717441Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins)
    contains Pfam PF00788 and Pfam 02196
  6. 717448Protein c-Raf1 RBD [54264] (2 species)
  7. 717453Species Rat (Rattus norvegicus) [TaxId:10116] [54266] (1 PDB entry)
  8. 717454Domain d1rrba_: 1rrb A: [37621]

Details for d1rrba_

PDB Entry: 1rrb (more details)

PDB Description: the ras-binding domain of raf-1 from rat, nmr, 1 structure
PDB Compounds: (A:) raf proto-oncogene serine/threonine-protein kinase

SCOP Domain Sequences for d1rrba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrba_ d.15.1.5 (A:) c-Raf1 RBD {Rat (Rattus norvegicus) [TaxId: 10116]}
ntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpeccavfrllqehkgkkarldwn
tdaasligeelqvdfl

SCOP Domain Coordinates for d1rrba_:

Click to download the PDB-style file with coordinates for d1rrba_.
(The format of our PDB-style files is described here.)

Timeline for d1rrba_: