Lineage for d1rrba_ (1rrb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932904Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2932911Protein c-Raf1 RBD [54264] (2 species)
  7. 2932921Species Norway rat (Rattus norvegicus) [TaxId:10116] [54266] (1 PDB entry)
  8. 2932922Domain d1rrba_: 1rrb A: [37621]

Details for d1rrba_

PDB Entry: 1rrb (more details)

PDB Description: the ras-binding domain of raf-1 from rat, nmr, 1 structure
PDB Compounds: (A:) raf proto-oncogene serine/threonine-protein kinase

SCOPe Domain Sequences for d1rrba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrba_ d.15.1.5 (A:) c-Raf1 RBD {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpeccavfrllqehkgkkarldwn
tdaasligeelqvdfl

SCOPe Domain Coordinates for d1rrba_:

Click to download the PDB-style file with coordinates for d1rrba_.
(The format of our PDB-style files is described here.)

Timeline for d1rrba_: