Lineage for d6kmba_ (6kmb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2321501Species Saccharomyces cerevisiae [TaxId:559292] [371895] (3 PDB entries)
  8. 2321510Domain d6kmba_: 6kmb A: [376209]
    automated match to d3qzta_
    complexed with gol

Details for d6kmba_

PDB Entry: 6kmb (more details), 2.4 Å

PDB Description: crystal structure of sth1 bromodomain
PDB Compounds: (A:) Nuclear protein STH1/NPS1

SCOPe Domain Sequences for d6kmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kmba_ a.29.2.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
lgifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknck
ngtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehs

SCOPe Domain Coordinates for d6kmba_:

Click to download the PDB-style file with coordinates for d6kmba_.
(The format of our PDB-style files is described here.)

Timeline for d6kmba_: