Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [371895] (3 PDB entries) |
Domain d6kmba_: 6kmb A: [376209] automated match to d3qzta_ complexed with gol |
PDB Entry: 6kmb (more details), 2.4 Å
SCOPe Domain Sequences for d6kmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kmba_ a.29.2.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} lgifptveklveemreqldevdshprtsifeklpskrdypdyfkviekpmaidiilknck ngtyktleevrqalqtmfenarfyneegswvyvdadklneftdewfkehs
Timeline for d6kmba_: