SCOPe 2.08: Domain d6is4a1: 6is4 A:123-219

Lineage for d6is4a1 (6is4 A:123-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [376189] (1 PDB entry)

8. Domain d6is4a1: 6is4 A:123-219 [376190]
   Other proteins in same PDB: d6is4a2
   automated match to d3q9va_
   complexed with mg, na

Details for d6is4a1

PDB Entry: 6is4, 1.85 Å

PDB Description: crystal structure of staphylococcus aureus response regulator arlr dna binding domain

PDB Compounds: (A:) Response regulator ArlR

SCOPe Domain Sequences for d6is4a1:

Sequence; same for both SEQRES and ATOM records:

>d6is4a1 a.4.6.0 (A:123-219) automated matches {Staphylococcus aureus [TaxId: 273036]}
diidvngitidknafkvtvngaeieltkteydllyllaenknhvmqreqilnhvwgynse
vetnvvdvyirylrnklkpydrdkmietvrgvgyvir

Timeline for d6is4a1:

• d6is4a1 first appeared in SCOPe 2.07