Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (13 proteins) contains Pfam PF00788 and Pfam 02196 |
Protein c-Raf1 RBD [54264] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54265] (3 PDB entries) |
Domain d1guab_: 1gua B: [37619] Other proteins in same PDB: d1guaa_ complexed with ca, gnp, mg; mutant |
PDB Entry: 1gua (more details), 2 Å
SCOP Domain Sequences for d1guab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guab_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} ntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpeccavfrllhehkgkkarldwn tdaasligeelqvdfl
Timeline for d1guab_: