Lineage for d6in5a2 (6in5 A:333-503)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646627Species Unidentified influenza virus [TaxId:11309] [315420] (5 PDB entries)
  8. 2646633Domain d6in5a2: 6in5 A:333-503 [376187]
    Other proteins in same PDB: d6in5a1, d6in5a3
    automated match to d1ha0a2
    complexed with gal, sia; mutant

Details for d6in5a2

PDB Entry: 6in5 (more details), 2.92 Å

PDB Description: crystal structure of h5n2 hemagglutinin g228s q226l mutant with 3sln from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6in5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6in5a2 h.3.1.0 (A:333-503) automated matches {Unidentified influenza virus [TaxId: 11309]}
gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqf
eavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvr
rqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid

SCOPe Domain Coordinates for d6in5a2:

Click to download the PDB-style file with coordinates for d6in5a2.
(The format of our PDB-style files is described here.)

Timeline for d6in5a2: