![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Unidentified influenza virus [TaxId:11309] [315420] (5 PDB entries) |
![]() | Domain d6in5a2: 6in5 A:333-503 [376187] Other proteins in same PDB: d6in5a1, d6in5a3 automated match to d1ha0a2 mutant |
PDB Entry: 6in5 (more details), 2.92 Å
SCOPe Domain Sequences for d6in5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6in5a2 h.3.1.0 (A:333-503) automated matches {Unidentified influenza virus [TaxId: 11309]} gaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkavdgitnkvnsiiskmnsqf eavgkefnnlerrienlnkkmedgfidvwtynaellvlmenertldlhdsnvknlydkvr rqlrdnakelgngcfefyhrcdnkcmesvrngtydypqyseesrlkreeid
Timeline for d6in5a2: