Lineage for d6in5a1 (6in5 A:3-323)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386458Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries)
  8. 2386476Domain d6in5a1: 6in5 A:3-323 [376186]
    Other proteins in same PDB: d6in5a2, d6in5a3
    automated match to d4we4a_
    complexed with gal, sia; mutant

Details for d6in5a1

PDB Entry: 6in5 (more details), 2.92 Å

PDB Description: crystal structure of h5n2 hemagglutinin g228s q226l mutant with 3sln from a/chicken/taiwan/0502/2012
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6in5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6in5a1 b.19.1.0 (A:3-323) automated matches {Unidentified influenza virus [TaxId: 11309]}
gdricigyhannsttqvdtimeknvtvthaqdilekehngrlcslkgvkplilkncsvag
wllgnpmcdeflnapewsyivekdrpsnglcypgtfnyyeelkhlmsstnqfekiqifpr
sswsnhdassgvssacpyngrssffrnvvwlikknnvyrtitrtynntniedlliiwgih
hpnnaaeqiklyqnpstyvsvgtstlnqrsipeiatrpkvnglssrmeffwtilrpndsi
tfestgnfiapeyaykivkkgdsaimkselsysncdtkcqtpvgainssmpfhnvhpfai
gecpkyvklkklvlatglrni

SCOPe Domain Coordinates for d6in5a1:

Click to download the PDB-style file with coordinates for d6in5a1.
(The format of our PDB-style files is described here.)

Timeline for d6in5a1: