SCOPe 2.08: Domain d6iq4h_: 6iq4 H:

Lineage for d6iq4h_ (6iq4 H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d6iq4h_: 6iq4 H: [376176]
   Other proteins in same PDB: d6iq4a_, d6iq4b_, d6iq4e_, d6iq4f_
   automated match to d5b2jd_
   protein/DNA complex; complexed with au, d0x, mg, xis

Details for d6iq4h_

PDB Entry: 6iq4, 2.25 Å

PDB Description: nucleosome core particle cross-linked with a hetero-binuclear molecule possessing rapta and gold(i) 4-(diphenylphosphino)benzoic acid groups.

PDB Compounds: (H:) Histone H2B type 1-J

SCOPe Domain Sequences for d6iq4h_:

Sequence; same for both SEQRES and ATOM records:

>d6iq4h_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d6iq4h_:

• d6iq4h_ first appeared in SCOPe 2.07