Lineage for d6j09a4 (6j09 A:247-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012169Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132
  4. 3012170Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) (S)
    Pfam PF07244
  5. 3012193Family d.391.1.0: automated matches [311585] (1 protein)
    not a true family
  6. 3012194Protein automated matches [311586] (2 species)
    not a true protein
  7. 3012198Species Haemophilus influenzae [TaxId:727] [376171] (1 PDB entry)
  8. 3012202Domain d6j09a4: 6j09 A:247-333 [376175]
    automated match to d2qdfa4

Details for d6j09a4

PDB Entry: 6j09 (more details), 3 Å

PDB Description: crystal structure of haemophilus influenzae bama potra1-4
PDB Compounds: (A:) Outer membrane protein assembly factor BamA

SCOPe Domain Sequences for d6j09a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j09a4 d.391.1.0 (A:247-333) automated matches {Haemophilus influenzae [TaxId: 727]}
ydlrsariignlggmsaelepllsalhlndtfrrsdiadvenaikaklgergygsatvns
vpdfddanktlaitlvvdagrrltvrq

SCOPe Domain Coordinates for d6j09a4:

Click to download the PDB-style file with coordinates for d6j09a4.
(The format of our PDB-style files is described here.)

Timeline for d6j09a4: