Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.4: First domain of FERM [54256] (5 proteins) |
Protein Erythroid membrane protein 4.1R [54261] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54262] (1 PDB entry) |
Domain d1gg3c3: 1gg3 C:1-81 [37617] Other proteins in same PDB: d1gg3a1, d1gg3a2, d1gg3b1, d1gg3b2, d1gg3c1, d1gg3c2 |
PDB Entry: 1gg3 (more details), 2.8 Å
SCOP Domain Sequences for d1gg3c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg3c3 d.15.1.4 (C:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens)} mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak eikkqvrgvpwnftfnvkfyp
Timeline for d1gg3c3: