SCOP 1.55: Domain d1gg3c3: 1gg3 C:1-81

Lineage for d1gg3c3 (1gg3 C:1-81)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.1: Ubiquitin-like [54236] (5 families)

5. Family d.15.1.4: First domain of FERM [54256] (3 proteins)

6. Protein Erythroid membrane protein 4.1R [54261] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54262] (1 PDB entry)

8. Domain d1gg3c3: 1gg3 C:1-81 [37617]
   Other proteins in same PDB: d1gg3a1, d1gg3a2, d1gg3b1, d1gg3b2, d1gg3c1, d1gg3c2

Details for d1gg3c3

PDB Entry: 1gg3, 2.8 Å

PDB Description: crystal structure of the protein 4.1r membrane binding domain

SCOP Domain Sequences for d1gg3c3:

Sequence; same for both SEQRES and ATOM records:

>d1gg3c3 d.15.1.4 (C:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens)}
mhckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsak
eikkqvrgvpwnftfnvkfyp

Timeline for d1gg3c3:

• d1gg3c3 appears in SCOP 1.57
  
• d1gg3c3 appears in the current release, SCOPe 2.08