Lineage for d6idwa_ (6idw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850551Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 2850552Protein automated matches [195758] (2 species)
    not a true protein
  7. 2850563Species Orpinomyces sp. [TaxId:884017] [334100] (2 PDB entries)
  8. 2850568Domain d6idwa_: 6idw A: [376166]
    automated match to d5jx5a_
    complexed with edo, gol, mpd, po4

Details for d6idwa_

PDB Entry: 6idw (more details), 2.78 Å

PDB Description: gh6 orpinomyces sp. y102 enzyme
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d6idwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6idwa_ c.6.1.0 (A:) automated matches {Orpinomyces sp. [TaxId: 884017]}
tsdnffenelysnykfqgevdqsiqrlsgslqekakkvkyvptaawlawsgatnevaryl
neagsktvvfvlymiptrdcnaggsnggadnlstyqgyvnsiyntinqypnsrivmiiep
dtignlvtannancrnvhdmhkqalsyaiskfgtqknvrvyldaahggwlnssadrtaev
iaeilrnagngkirgistnvsnyqpvyseyqyhqnlnralesrgvrgmkfivdtsrngrn
pssatwcnlkgaglgarpqanpdpnmplldayvwiktpgesdsassadpvcrnsdslqga
paagswfhdyfvmllenanppf

SCOPe Domain Coordinates for d6idwa_:

Click to download the PDB-style file with coordinates for d6idwa_.
(The format of our PDB-style files is described here.)

Timeline for d6idwa_: